HPA021509

ENTPD8 antibody from Sigma-Aldrich
NTPDase-8, UNQ2492
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021509
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021509, RRID:AB_1848185
Product name
Anti-ENTPD8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021509
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHTSLFLYQWPANKENGTGVVSQALACQVEGPGIS
SYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTF
LGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVD
FWGAELLAGQAEGAFGWITVNYGLG
Storage
-20C
Provider Type Product Number
- No reagents -