SAB2100685

ENTPD8 antibody from Sigma-Aldrich
NTPDase-8, UNQ2492
No application information provided.

Antibody data

Product number
SAB2100685
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100685, RRID:AB_10604494
Product name
Anti-ENTPD8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100685
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001028285.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDI
FAAVTQVLGRSPVDF
Storage
-20C
Provider Type Product Number
- No reagents -