HPA019819

BAZ2B antibody from MilliporeSigma / Merck KGaA
WALp4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019819
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019819, RRID:AB_1845282
Product name
Anti-BAZ2B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019819
Antibody type
Polyclonal
Antigen
Bromodomain adjacent to zinc finger domain protein 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAGANGCTLSYQNSGKHSLGSVQSTATQSNVEKAD
SNNLFNTGSSGPGKFYSPLPNDQLLKTLTEKNRQW
FSLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKS
Storage
-20C
Provider Type Product Number
- No reagents -