HPA008355

ANKS6 antibody from Sigma-Aldrich
ANKRD14, FLJ36928, NPHP16, SAMD6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008355, RRID:AB_2058277
Product name
Anti-ANKS6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008355
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SAM domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQ
SKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFE
EQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAI
SELNAGKGRERQILQETIHNFHSSF
Storage
-20C
Provider Type Product Number
- No reagents -