HPA008356

RET antibody from Sigma-Aldrich
CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET51
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008356, RRID:AB_1847232
Product name
Anti-RET antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008356
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase receptor ret precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFG
KVVKATAFHLKGRAGYTTVAVKMLKENASPSELRD
LLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEY
AKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHP
DERALTM
Storage
-20C
Provider Type Product Number
- No reagents -