HPA023679

NRDC antibody from MilliporeSigma / Merck KGaA
hNRD1, hNRD2, NRD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023679
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023679, RRID:AB_1854638
Product name
Anti-NRD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023679
Antibody type
Polyclonal
Antigen
Nardilysin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQF
QVVELPSGHHLCKVKALNKGDANSEVTVYYQSGTR
SLR
Storage
-20C
Provider Type Product Number
- No reagents -