HPA014948

SLC37A2 antibody from Sigma-Aldrich
FLJ00171
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014948, RRID:AB_2190374
Product name
Anti-SLC37A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014948
Antibody type
Polyclonal
Antigen
Sugar phosphate exchanger 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCS
WAPFDKDNYKE
Storage
-20C
Provider Type Product Number
- No reagents -