AV36024

ZNF649 antibody from Sigma-Aldrich
FLJ12644
No application information provided.

Antibody data

Product number
AV36024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36024, RRID:AB_1848697
Product name
Anti-FLJ12644 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36024
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human FLJ12644 with an internal ID of P07334
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
CDECEKAYFYMSCLVKHKRIHSREKRGDSVKVENP
STASHSLSPSEHVQG
Storage
-20C
Provider Type Product Number
- No reagents -