HPA026541

ZNF649 antibody from Sigma-Aldrich
FLJ12644
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026541
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026541, RRID:AB_1859390
Product name
Anti-ZNF649 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026541
Antibody type
Polyclonal
Antigen
Zinc finger protein 649 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENYSNLVSVGYQAGKPDALTKLEQGEPLWTLEDEI
HSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHG
RTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNH
EQMPTEIEFPESRKPISTKSQFL
Storage
-20C
Provider Type Product Number
- No reagents -