Antibody data

Product number
H00079898-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079898-B01, RRID:AB_1116329
Product name
ZNF613 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079898-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF613 protein.
Antigen sequence
MIKSQESLTLEDVAVEFTWEEWQLLGPAQKDLYRD
VMLENYSNLVSVGYQASKPDALFKLEQGEPWTVEN
EIHSQICPEIKKVNNHLQMHSQKQRCLKRVEQCHK
HNAFGNIIHQRKSDFPLRQNHDTFDLHGKILKSNL
SLVNQNKRYEIKNSVGVNGDGKSFLHAKHEQFHNE
MNFPEGGNSVNTNSQFIKHQRTQNIDKPHVCTECG
KAFLKKSRLIYHQRVHTGEKPHGCSICGKAFSRKS
GLTEHQRNHTGEKPYECTECDKAFRWKSQLNAHQK
IHTGEKSYICSDCGKGFIKKSRLINHQRVHTGEKP
HGCSLCGKAFSKRSRLTEHQRTHTGEKPYECTECD
KAFRWKSQLNAHQKAHTGEKSYICRDCGKGFIQKG
NLIVHQRIHTGEKPYICNECGKGFIQKGNLLIHRR
THTGEKPYVCNECGKGFSQKTCLISHQRFHTGKTP
FVCTECGKSCSHKSGLINHQRIHTGEKPYTCSDCG
KAFRDKSCLNRHRRTHTGERPYGCSDCGKAFSHLS
CLVYHKGMLHAREKCVGSVKLENPCSESHSLSHTR
DLIQDKDSVNMVTLQMPSVAAQTSLTNSAFQAESK
VAIVSQPVARSSVSADSRICTE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -