AV36048

ZNF613 antibody from Sigma-Aldrich
FLJ13590
No application information provided.

Antibody data

Product number
AV36048
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36048, RRID:AB_1859378
Product name
Anti-ZNF613 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36048
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF613 with an internal ID of P07358
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVGSVKLENPCSESHSLSHTRDLIQDKDSVNMVTL
QMPSVAAQTSLTNSA
Storage
-20C
Provider Type Product Number
- No reagents -