Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010645-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010645-M02, RRID:AB_626399
- Product name
- CAMKK2 monoclonal antibody (M02), clone 4C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
- Antigen sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCE
ALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR
DRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERS
QGGLAAGGSLDMNGRCICPSLPYSP- Isotype
- IgG
- Antibody clone number
- 4C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Regulation of Rac1 by simvastatin in endothelial cells: differential roles of AMP-activated protein kinase and calmodulin-dependent kinase kinase-beta.
Kou R, Sartoretto J, Michel T
The Journal of biological chemistry 2009 May 29;284(22):14734-43
The Journal of biological chemistry 2009 May 29;284(22):14734-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAMKK2 monoclonal antibody (M02), clone 4C7 Western Blot analysis of CAMKK2 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAMKK2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol