Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010645-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010645-M01, RRID:AB_464266
- Product name
- CAMKK2 monoclonal antibody (M01), clone 1A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
- Antigen sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCE
ALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR
DRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERS
QGGLAAGGSLDMNGRCICPSLPYSP- Isotype
- IgG
- Antibody clone number
- 1A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A regulatory feedback loop between Ca2+/calmodulin-dependent protein kinase kinase 2 (CaMKK2) and the androgen receptor in prostate cancer progression.
Karacosta LG, Foster BA, Azabdaftari G, Feliciano DM, Edelman AM
The Journal of biological chemistry 2012 Jul 13;287(29):24832-43
The Journal of biological chemistry 2012 Jul 13;287(29):24832-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAMKK2 monoclonal antibody (M01), clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAMKK2 monoclonal antibody (M01), clone 1A11. Western Blot analysis of CAMKK2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody (M01), clone 1A11.Lane 1: CAMKK2 transfected lysate(59.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAMKK2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CAMKK2 transfected lysate using anti-CAMKK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CAMKK2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol