HPA017389

CAMKK2 antibody from Sigma-Aldrich
CAMKK, CAMKKB, KIAA0787, MGC15254
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017389
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017389, RRID:AB_1845956
Product name
Anti-CAMKK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017389
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEA
LRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARD
RPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQ
GGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
Storage
-20C
Provider Type Product Number
- No reagents -