H00007529-M02A

YWHAB antibody from Abnova Corporation
YWHAA
No application information provided.

Antibody data

Product number
H00007529-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007529-M02A, RRID:AB_1205181
Product name
YWHAB monoclonal antibody (M02A), clone 1F11
Provider product page
Abnova Corporation - H00007529-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant YWHAB.
Antigen sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQG
HELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK
TERNEERQQMGKEYREKIEAELQDICNDVLELLDK
YLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK
QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALN
FSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE
ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGE
N
Isotype
IgM
Antibody clone number
1F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -