Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30579 - Provider product page
- Provider
- Abnova Corporation
- Product name
- YWHAB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human YWHAB.
- Antigen sequence
ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFR
YLSEVASGDNKQTTVSNSQQAYQEAFEISKKE- Isotype
- IgG
- Storage
- Store at 4°C for short term storage. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).Lane 1: Human cell line RT-4Lane 2: Human cell line U-251MG sp
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)