HPA007925

YWHAB antibody from Atlas Antibodies
YWHAA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007925
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007925, RRID:AB_1233380
Product name
Anti-YWHAB
Provider product page
Atlas Antibodies - HPA007925
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKT
DTSDKKLQLIKDYREKVESELRSICTTVLELLDKY
LIANATNPESKVFYLKMKGDYFRY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -