HPA011212

YWHAB antibody from Sigma-Aldrich
YWHAA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011212
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011212, RRID:AB_1844334
Product name
Anti-YWHAB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011212
Antibody type
Polyclonal
Antigen
14-3-3 protein beta/alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFR
YLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
Storage
-20C
Provider Type Product Number
- No reagents -