Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005865-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005865-M01, RRID:AB_464361
- Product name
- RAB3B monoclonal antibody (M01), clone 3F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB3B.
- Antigen sequence
IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLA
EQLGFDFFEASAKENISVRQAFERLVDAICDKMSD
SLDTDPSMLGSSKNTRLSDTPPLLQQNCSC- Isotype
- IgG
- Antibody clone number
- 3F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
Vogel GF, Klee KM, Janecke AR, Müller T, Hess MW, Huber LA
The Journal of cell biology 2015 Nov 9;211(3):587-604
The Journal of cell biology 2015 Nov 9;211(3):587-604
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12.Lane 1: RAB3B transfected lysate(24.758 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB3B monoclonal antibody (M01), clone 3F12. Western Blot analysis of RAB3B expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RAB3B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol