Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005865-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005865-M02, RRID:AB_10554384
- Product name
- RAB3B monoclonal antibody (M02), clone 1A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB3B.
- Antigen sequence
IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLA
EQLGFDFFEASAKENISVRQAFERLVDAICDKMSD
SLDTDPSMLGSSKNTRLSDTPPLLQQNCSC- Isotype
- IgG
- Antibody clone number
- 1A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M02), clone 1A7.Lane 1: RAB3B transfected lysate(24.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of RAB3B transfected lysate using anti-RAB3B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RAB3B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol