ABIN630197

antibody from antibodies-online

Targeting: RBMS1 C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630197 - Provider product page
Provider: antibodies-online
Product name: anti-RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1) (C-Term) antibody
Antibody type: Polyclonal
Antigen: RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ
Description: Purified
Reactivity: Human, Mouse, Canine
Host: Rabbit
Epitope: C-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

RBMS1 protein structure - ABIN630197 shown in red.