ABIN183954
antibody from antibodies-online
Targeting: RBMS1
C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183954 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBMS1 antibody: synthetic peptide directed towards the middle region of human RBMS1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWH
REGEA GMTLTYDPTT- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references MSSP, a protein binding to an origin of replication in the c-myc gene, interacts with a catalytic subunit of DNA polymerase alpha and stimulates its polymerase activity.
Niki T, Galli I, Ariga H, Iguchi-Ariga SM
FEBS letters 2000 Jun 23;475(3):209-12
FEBS letters 2000 Jun 23;475(3):209-12
No comments: Submit comment
No validations: Submit validation data