Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406432 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Stratifin (SFN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSY
KDSTL IMQLLRDNLT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nicotinamide N-methyl transferase (NNMT) gene polymorphisms and risk for spina bifida.
CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2.
Lu W, Zhu H, Wen S, Yang W, Shaw GM, Lammer EJ, Finnell RH
Birth defects research. Part A, Clinical and molecular teratology 2008 Oct;82(10):670-5
Birth defects research. Part A, Clinical and molecular teratology 2008 Oct;82(10):670-5
CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2.
Yang W, Dicker DT, Chen J, El-Deiry WS
Cell cycle (Georgetown, Tex.) 2008 Mar 1;7(5):670-82
Cell cycle (Georgetown, Tex.) 2008 Mar 1;7(5):670-82
No comments: Submit comment
No validations: Submit validation data