ABIN406432

SFN antibody from antibodies-online
YWHAS
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN406432
Provider
antibodies-online
Product name
anti-Stratifin (SFN) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406432
Antibody type
Polyclonal
Antigen
The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
Host
Rabbit
Antigen sequence
FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSY
KDSTL IMQLLRDNLT
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -