Antibody data

Product number
ABIN503870
Provider
antibodies-online
Product name
anti-Stratifin (SFN) antibody
Provider product page
antibodies-online - ABIN503870
Antibody type
Polyclonal
Antigen
The immunogen for anti-RPS15 antibody: synthetic peptide directed towards the middle region of human RPS15
Reactivity
Human, Mouse, Rat, Chicken/Avian
Host
Rabbit
Antigen sequence
GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHG
RPGIG ATHSSRFIPL
Vial size
50 µg
Provider Type Product Number
- No reagents -