HPA011105

SFN antibody from Sigma-Aldrich
YWHAS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011105, RRID:AB_1844339
Product name
Anti-SFN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011105
Antibody type
Polyclonal
Antigen
14-3-3 protein sigma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG
PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGD
AESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSAR
SAYQEAMDISKKEMP
Storage
-20C
Provider Type Product Number
- No reagents -