HPA027160

MRPL41 antibody from Atlas Antibodies
BMRP, MRP-L27, MRPL27, PIG3, RPML27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027160
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027160, RRID:AB_1854113
Product name
Anti-MRPL41
Provider product page
Atlas Antibodies - HPA027160
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGW
RFVQIKEMVPEFVVPDLTGFKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -