HPA022911

DPH7 antibody from Sigma-Aldrich
C9orf112, FLJ90634, RRT2, WDR85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022911, RRID:AB_1858823
Product name
Anti-WDR85 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022911
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 85 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELP
TPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTW
LQATAATTRDCGVNPEEADSA
Storage
-20C
Provider Type Product Number
- No reagents -