HPA020642

ZMYND19 antibody from Sigma-Aldrich
MIZIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020642, RRID:AB_1859078
Product name
Anti-ZMYND19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020642
Antibody type
Polyclonal
Antigen
Zinc finger MYND domain-containing protein 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYS
FEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE
LLWERH
Storage
-20C
Provider Type Product Number
- No reagents -