Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005055-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005055-M08, RRID:AB_714822
- Product name
- SERPINB2 monoclonal antibody (M08), clone 3A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SERPINB2.
- Antigen sequence
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSI
SSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP
MTPENFTSCGFMQQIQKGSYPDAILQAQAA- Isotype
- IgG
- Antibody clone number
- 3A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SERPINB2 monoclonal antibody (M08), clone 3A9. Western Blot analysis of SERPINB2 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SERPINB2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SERPINB2 transfected lysate using anti-SERPINB2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SERPINB2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol