HPA015480

SERPINB2 antibody from Sigma-Aldrich
HsT1201, PAI2, PLANH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015480, RRID:AB_1855456
Product name
Anti-SERPINB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015480
Antibody type
Polyclonal
Antigen
Plasminogen activator inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWK
TPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIG
YIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGL
ELLESEITYDKLNKWTSKD
Storage
-20C
Provider Type Product Number
- No reagents -