HPA015480

SERPINB2 antibody from Atlas Antibodies
HsT1201, PAI2, PLANH2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015480
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015480, RRID:AB_1855456
Product name
Anti-SERPINB2
Provider product page
Atlas Antibodies - HPA015480
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWK
TPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIG
YIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGL
ELLESEITYDKLNKWTSKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -