Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015480 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015480, RRID:AB_1855456
- Product name
- Anti-SERPINB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWK
TPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIG
YIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGL
ELLESEITYDKLNKWTSKD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Matrix remodeling stimulates stromal autophagy, “fueling” cancer cell mitochondrial metabolism and metastasis
Genome-wide high-resolution aCGH analysis of gestational choriocarcinomas.
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Castello-Cros R, Bonnuccelli G, Molchansky A, Capozza F, Witkiewicz A, Birbe R, Howell A, Pestell R, Whitaker-Menezes D, Sotgia F, Lisanti M
Cell Cycle 2014 November;10(12):2021-2034
Cell Cycle 2014 November;10(12):2021-2034
Genome-wide high-resolution aCGH analysis of gestational choriocarcinomas.
Poaty H, Coullin P, Peko JF, Dessen P, Diatta AL, Valent A, Leguern E, Prévot S, Gombé-Mbalawa C, Candelier JJ, Picard JY, Bernheim A
PloS one 2012;7(1):e29426
PloS one 2012;7(1):e29426
Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.
- Sample type
- HUMAN