HPA003438

IFT43 antibody from Sigma-Aldrich
C14orf179, FLJ32173, MGC16028
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003438
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003438, RRID:AB_1078327
Product name
Anti-C14orf179 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003438
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf179 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMK
YSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDW
DHLFTEVSSEVLTEWDPLQTEKEDPA
Storage
-20C
Provider Type Product Number
- No reagents -