HPA007927

SPTAN1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007927, RRID:AB_1857435
Product name
Anti-SPTAN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007927
Antibody type
Polyclonal
Antigen
Spectrin alpha chain, brain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVD
PNRDGHVSLQEYMAFMISRETENVKSSEEIESAFR
ALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYV
DGKGRELPTAFDYVEFTRSLF
Storage
-20C
Provider Type Product Number
- No reagents -