HPA006114

CTD-2589C9.4 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006114
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006114, RRID:AB_1079067
Product name
Anti-HMBS antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006114
Antibody type
Polyclonal
Antigen
Porphobilinogen deaminase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHA
LEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENP
HDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQL
QRKFPHLEFRSIRGNLNTRL
Storage
-20C
Provider Type Product Number
- No reagents -