Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449869 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 83 (ZNF83) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human ZNF8
- Description
- Peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEG
KIYKYDHMEKSVNSS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references PU.1 and NFATc1 mediate osteoclastic induction of the mouse beta3 integrin promoter.
Crotti TN, Sharma SM, Fleming JD, Flannery MR, Ostrowski MC, Goldring SR, McHugh KP
Journal of cellular physiology 2008 Jun;215(3):636-44
Journal of cellular physiology 2008 Jun;215(3):636-44
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human ACHN; WB Suggested Anti-ZNF83 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: ACHN cell lysate; ZNF83 antibody - N-terminal region (AP44430PU-N) in Human ACHN cells using Western Blot