HPA025970

ZNF83 antibody from Sigma-Aldrich
FLJ11015, HPF1, ZNF816B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025970
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025970, RRID:AB_1859463
Product name
Anti-ZNF83 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025970
Antibody type
Polyclonal
Antigen
Zinc finger protein 83 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGK
IYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTY
ECNFVDSLFTQKEKANIGTEHYKCSERGKAFHQGL
HFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQR
IHTGEKPYKC
Storage
-20C
Provider Type Product Number
- No reagents -