H00055852-B01

TEX2 antibody from Abnova Corporation
HT008, KIAA1738, TMEM96

Antibody data

Product number
H00055852-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055852-B01, RRID:AB_1139000
Product name
TEX2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055852-B01
Antibody type
Polyclonal
Antigen
TEX2 (AAH40521, 1 a.a. ~ 1134 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MTSLYGRHAEKTTDMPKPSAPKVHVQRSVSRDTIA
IHFSASGEEEEEEEEEFKEYFEEGLDDQSIVTGLE
AKEDLYLEPQVGHDPAGPAASPVLADGLSVSQAPA
ILPVSKNTVKLLESPVPAAQVLSTVPLAVSPGSSS
SGPLASSPSVSSLSEQKTSSSSPLSSPSKSPILSS
SASTSTLSSAKPFMSLVKSLSTEVEPKESPHPARH
RHLMKTLVKSLSTDTSRQESDTVSYKPPDSKLNLH
LFKQFTQPRNTGGDSKTAPSSPLTSPSDTRSFFKV
PEMEAKIEDTKRRLSEVIYEPFQLLSKIIGEESGS
HRPKALSSSASELSNLSSLNGHLESNNNYSIKEEE
CDSEGDGYGSDSNIPRSDHPKSTGEPTREIELKSS
QGSSLKDLGLKTSSLVLEKCSLSALVSKEDEEFCE
LYTEDFDLETEGESKVDKLSDIPLKPEVLAKDGVV
LDSEDEVDSAVQHPELPVKTLGFFIMCVYVYLILP
LPHYVSGLFLGIGLGFMTAVCVIWFFTPPSAHKYH
KLHKNLRHWNTRSLDIKEPEILKGWMNEIYNYDPE
TYHATLTHSVFVRLEGGTLRLSKPNKNISRRASYN
EPKPEVTYISQKIYDLSDSKIYLVPKTLARKRIWN
KKYPICIELGQQDDFMSKAQTDKETSEEKPPAEGS
EDPKKPPRPQEGTRSSQRDQILYLFGRTGREKEEW
FRRFILASKLKSEIKKSSGVSGGKPAPVFLAPGLL
PAHSRHNSPSGHLTHSRSSSKGSVEEIMSQPKQKE
LAGSVRQKMLLDYSVYMGRCVPQESRSPQRSPLQS
AESSPTAGKKLPEVPPSEEEEQEAWVNALLGRIFW
DFLGEKYWSDLVSKKIQMKLSKIKLPYFMNELTLT
ELDMGVAVPKILQAFKPYVDHQGLWIDLEMSYNGS
FLMTLETKMNLTKLGKEPLVEALKVGEIGKEGCRP
RAFCLADSDEESSSAGSSEEDDAPEPSGGDKQLLP
GAEGYVGGHRTSKIMRFVDKITKSKYFQKATETEF
IKKKIEEVSNTPLLLTVEVQECRGTLAVNIPPPPT
DRVWYGFRKPPHVELKARPKLGEREVTLVHVTDWI
EKKLEQEFQKVFVMPNMDDVYITIMHSAMDPRSTS
CLLKDPPVEAADQP
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -