HPA018039

KCNH7 antibody from MilliporeSigma / Merck KGaA
erg3, HERG3, Kv11.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018039
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018039, RRID:AB_1852125
Product name
Anti-KCNH7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018039
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily H member 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNCKLRRRKLSFESEGEKENSTNDPEDSADTIRHY
QSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDS
SPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDIT
DMRSWERENAHPQPEDSSPSALQRAA
Storage
-20C
Provider Type Product Number
- No reagents -