HPA006360

HPRT1 antibody from Sigma-Aldrich
HGPRT, HPRT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006360
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006360, RRID:AB_1079082
Product name
Anti-HPRT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006360
Antibody type
Polyclonal
Antigen
Hypoxanthine-guanine phosphoribosyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDR
TERLARDVMKEMGGHHIVALCVLKGGYKFFADLLD
YIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIK
VIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLV
RQYNPKMV
Storage
-20C
Provider Type Product Number
- No reagents -