HPA023559

CTBP2 antibody from Sigma-Aldrich
ribeye
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023559
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023559, RRID:AB_1847309
Product name
Anti-CTBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023559
Antibody type
Polyclonal
Antigen
C-terminal-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVDPSSAAAPEGSTGVAPGALNRGYGPARESIPSK
MAYETYEADLSTFQGPGGKRTVLPEFLAFLRAEGL
AEATLGALLQQGFDSPAVLATLEDADIKSVAPNL
Storage
-20C
Provider Type Product Number
- No reagents -