HPA025809

ARMC2 antibody from Sigma-Aldrich
bA787I22.1, DKFZp434P0714
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025809, RRID:AB_1845032
Product name
Anti-ARMC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025809
Antibody type
Polyclonal
Antigen
Armadillo repeat-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEEN
IETVCAACTQLHHALEEGNMLGNKFKGRSILLKTL
CKLVDVGSDSLS
Storage
-20C
Provider Type Product Number
- No reagents -