HPA023599

ZNF160 antibody from Sigma-Aldrich
F11, FLJ00032, HKr18, HZF5, KIAA1611, KR18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023599, RRID:AB_2218442
Product name
Anti-ZNF160 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023599
Antibody type
Polyclonal
Antigen
Zinc finger protein 160 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARK
PRTRECVKGVVTDIPPKCTIKDLLPKEKSSTEAVF
HTVVLERHESPDIEDFSFKEPQKNVHDFECQWRDD
TGNYKGVLMAQKEGKRDQRDRRDIENKLMNNQLGV
SFHSHLP
Storage
-20C
Provider Type Product Number
- No reagents -