HPA025829

GPX7 antibody from Sigma-Aldrich
FLJ14777, GPX6, NPGPx
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025829
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025829, RRID:AB_10603766
Product name
Anti-GPX7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025829
Antibody type
Polyclonal
Antigen
glutathione peroxidase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKI
AVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDG
KVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Storage
-20C
Provider Type Product Number
- No reagents -