HPA016928

HEBP2 antibody from Sigma-Aldrich
C6orf34, SOUL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016928, RRID:AB_1850572
Product name
Anti-HEBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016928
Antibody type
Polyclonal
Antigen
Heme-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFT
KLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSE
STITISLYIPSEQQFDPPRPLESDVFIEDRAEMTV
FVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEK
VYYTA
Storage
-20C
Provider Type Product Number
- No reagents -