HPA026731

ECHDC2 antibody from Sigma-Aldrich
FLJ10948
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026731
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026731, RRID:AB_1847969
Product name
Anti-ECHDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026731
Antibody type
Polyclonal
Antigen
Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSEIQVRALAGPDQGITEILMNRPSARNALGNVFV
SELLETLAQLREDRQVRVLLFRSGVKGVFCAGADL
KEREQMSEAEVGVFVQRLR
Storage
-20C
Provider Type Product Number
- No reagents -