HPA026768

ECHDC2 antibody from MilliporeSigma / Merck KGaA
FLJ10948
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026768
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ECHDC2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026768
Antibody type
Polyclonal
Antigen
Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR
ARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGM
Storage
-20C