HPA008451

EPS15 antibody from Atlas Antibodies
AF-1P, MLLT5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008451
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008451, RRID:AB_1848221
Product name
Anti-EPS15
Provider product page
Atlas Antibodies - HPA008451
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHN
DPFAPGGTVVAASDSATDPFASVFGNESFGGGFAD
FSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETS
VKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDS
PD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -