HPA008451

EPS15 antibody from Sigma-Aldrich
AF-1P, MLLT5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008451
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008451, RRID:AB_1848221
Product name
Anti-EPS15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008451
Antibody type
Polyclonal
Antigen
Epidermal growth factor receptor substrate 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHN
DPFAPGGTVVAASDSATDPFASVFGNESFGGGFAD
FSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETS
VKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDS
PD
Storage
-20C
Provider Type Product Number
- No reagents -