Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024796 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024796, RRID:AB_1859410
- Product name
- Anti-ZNF677
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSIHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLK
NNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTG
EKMYECNPVEK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references DNA methylation transcriptionally regulates the putative tumor cell growth suppressor ZNF677 in non-small cell lung cancers.
Heller G, Altenberger C, Schmid B, Marhold M, Tomasich E, Ziegler B, Müllauer L, Minichsdorfer C, Lang G, End-Pfützenreuter A, Döme B, Arns BM, Fong KM, Wright CM, Yang IA, Klepetko W, Zielinski CC, Zöchbauer-Müller S
Oncotarget 2015 Jan 1;6(1):394-408
Oncotarget 2015 Jan 1;6(1):394-408
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
- Sample type
- HUMAN