HPA024796

ZNF677 antibody from Sigma-Aldrich
MGC48625
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024796, RRID:AB_1859410
Product name
Anti-ZNF677 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024796
Antibody type
Polyclonal
Antigen
Zinc finger protein 677 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSIHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLK
NNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTG
EKMYECNPVEK
Storage
-20C
Provider Type Product Number
- No reagents -